PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00101.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family NAC
Protein Properties Length: 317aa    MW: 36313.2 Da    PI: 4.9069
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00101.1_g00003.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.61.2e-5381362129
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWk 84 
                              ppG+rFhPtdeelv++yLk+kv+   l++ +vik+vd+yk+ePwd+++   + ++ee+ewyfFs +dkky+tg+r+nrat sg+Wk
  Rsa1.0_00101.1_g00003.1   8 PPGYRFHPTDEELVDYYLKNKVAFPGLQV-DVIKDVDLYKIEPWDIQElcgRGAGEEREWYFFSYKDKKYPTGTRTNRATVSGFWK 92 
                              9****************************.99**************954554455788**************************** PP

                      NAM  85 atgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                              atg+dk+++s k+elvg++ktLvfykgrap+g+k+dW+mheyrle
  Rsa1.0_00101.1_g00003.1  93 ATGRDKAIYS-KQELVGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                              **********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-594156IPR003441NAC domain
PROSITE profilePS5100557.7847156IPR003441NAC domain
PfamPF023651.9E-278135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MENLSRIPPG YRFHPTDEEL VDYYLKNKVA FPGLQVDVIK DVDLYKIEPW DIQELCGRGA  60
GEEREWYFFS YKDKKYPTGT RTNRATVSGF WKATGRDKAI YSKQELVGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETDEN GPPHEEGWVV CRAFKKKLTP INYNNPRTVM GSSSGQDSNW  180
FPQQMDVANG NYYHLPDIES PIMLQGSSSS SLHHNENDPY GVALGTINAA PSTLMQRDDE  240
GDHGRIITND ASHMVMMNTN IDHHHHQSGL LLNDDDDYND QLMDWQSLDK LVASQLILSQ  300
EEEAVNQDPS NNFSNET
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-48715715169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013705717.10.0PREDICTED: NAC domain-containing protein 101-like
RefseqXP_013705716.10.0PREDICTED: NAC domain-containing protein 101-like
SwissprotQ9LVA10.0NC101_ARATH; NAC domain-containing protein 101
TrEMBLA0A078DD960.0A0A078DD96_BRANA; BnaC09g05610D protein
STRINGBra035896.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM122481732
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62380.10.0NAC-domain protein 101